PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01570.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 195aa    MW: 22542.7 Da    PI: 9.8458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01570.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W +eEd +l ++v+ +G g+W+ I+r+ g++R++k+c++rw +yl
  Rsa1.0_01570.1_g00007.1 14 RGLWKPEEDVILRRCVESHGEGNWADISRRSGLKRSGKSCRLRWKNYL 61
                             788*******************************************97 PP

2Myb_DNA-binding50.35.3e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
  Rsa1.0_01570.1_g00007.1  67 RGGMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112
                              6779******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-22864IPR009057Homeodomain-like
PROSITE profilePS5129426.926965IPR017930Myb domain
SuperFamilySSF466891.39E-2911108IPR009057Homeodomain-like
SMARTSM007172.9E-151363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001671.47E-111761No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2365115IPR009057Homeodomain-like
PROSITE profilePS5129419.83166116IPR017930Myb domain
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.7E-1467112IPR001005SANT/Myb domain
CDDcd001673.69E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MEKREEKRKS NVKRGLWKPE EDVILRRCVE SHGEGNWADI SRRSGLKRSG KSCRLRWKNY  60
LRPNIKRGGM SPQEQDLIIR MHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKSNSRI  120
QNGPELVEAS PDKPVMSTGV RQSHGEEVTI TNWVEETNYF GYDVCMGSPL PLISHYTDNL  180
VFDPCSAFAD FFPLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-23141187110B-MYB
1h8a_C1e-221411527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196371e-107AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013686846.11e-114PREDICTED: transcription factor MYB82-like
SwissprotQ9LTF71e-110MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A078J2101e-114A0A078J210_BRANA; BnaA03g12580D protein
TrEMBLM4EJZ61e-114M4EJZ6_BRARP; Uncharacterized protein
STRINGBra029113.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.12e-99myb domain protein 82